PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN30676.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 323aa    MW: 36642 Da    PI: 9.4426
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN30676.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.94.7e-083276345
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                     +WT+ E +l+ +a + + ++   +W+++a++++ g+t  +++  + 
       KHN30676.1 32 KWTPAENKLFENALAVYDKDtpeRWHKVAEMIP-GKTVMDVVKQYK 76
                     8********************************.***998887775 PP

2Myb_DNA-binding43.95.6e-14140184347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r    +Rt+ q+ s+ qky
       KHN30676.1 140 PWTEEEHKLFLLGLKKYGKGDWRNISRNYVITRTPTQVASHAQKY 184
                      8*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.5822882IPR017884SANT domain
SMARTSM007171.5E-92981IPR001005SANT/Myb domain
SuperFamilySSF466893.98E-113184IPR009057Homeodomain-like
CDDcd001674.02E-83278No hitNo description
Gene3DG3DSA:1.10.10.603.4E-43275IPR009057Homeodomain-like
PfamPF002491.6E-63276IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-12132189IPR009057Homeodomain-like
PROSITE profilePS5129420.5133189IPR017930Myb domain
SuperFamilySSF466891.08E-16134188IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-17136188IPR006447Myb domain, plants
SMARTSM007171.1E-12137187IPR001005SANT/Myb domain
CDDcd001676.67E-11140185No hitNo description
PfamPF002491.6E-12140184IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MKWEMEILPP ASPYTYNSNW LLDDNRTNNN TKWTPAENKL FENALAVYDK DTPERWHKVA  60
EMIPGKTVMD VVKQYKELEA DVCDIEAGLI SIPGYRSTTT TSPFTLDWVN PAYGDGFKGL  120
TAKRSSSGRP PEQERKKGVP WTEEEHKLFL LGLKKYGKGD WRNISRNYVI TRTPTQVASH  180
AQKYFIRQLS GGKDKRRASI HDITTVNLTE TTRTSSDESK RSTSPQHSTI LSHQQQQQQQ  240
PNSSVTSSGL NLQWSNQPNA GVAMPLNPAH EQVFMSPYGL NSYGFKMHGQ NLHRSSVHES  300
SYLGPQTPNM VFQMLPSQHY SHA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-1433981176RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003538252.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-120DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0B2R8460.0A0A0B2R846_GLYSO; Transcription factor MYB1R1
STRINGGLYMA11G22960.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.12e-88Homeodomain-like transcriptional regulator
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]